![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.8: Choline kinase [90040] (2 proteins) Pfam PF02958 |
![]() | Protein Choline kinase [90041] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311002] (13 PDB entries) |
![]() | Domain d5eqpa_: 5eqp A: [310523] automated match to d2i7qa_ complexed with 5r9 |
PDB Entry: 5eqp (more details), 2.35 Å
SCOPe Domain Sequences for d5eqpa_:
Sequence, based on SEQRES records: (download)
>d5eqpa_ d.144.1.8 (A:) Choline kinase {Human (Homo sapiens) [TaxId: 9606]} qpeprtrrraylwckeflpgawrglredefhisvirgglsnmlfqcslpdttatlgdepr kvllrlygailqmrscnkegseqaqkenefqgaeamvlesvmfailaerslgpklygifp qgrleqfipsrrldteelslpdisaeiaekmatfhgmkmpfnkepkwlfgtmekylkevl rikfteesrikklhkllsynlplelenlrsllestpspvvfchndcqegnilllegrens ekqklmlidfeyssynyrgfdignhfcewmydysyekypffranirkyptkkqqlhfiss ylpafqndfenlsteeksiikeemllevnrfalashflwglwsivqakissiefgymdya qarfdayfhqkrklgv
>d5eqpa_ d.144.1.8 (A:) Choline kinase {Human (Homo sapiens) [TaxId: 9606]} qpeprtrrraylwckeflpgawrglredefhisvirgglsnmlfqcslpdttatlgdepr kvllrlygaeamvlesvmfailaerslgpklygifpqgrleqfipsrrldteelslpdis aeiaekmatfhgmkmpfnkepkwlfgtmekylkevlrikfteesrikklhkllsynlple lenlrsllestpspvvfchndcqegnilllegrensekqklmlidfeyssynyrgfdign hfcewmydysyekypffranirkyptkkqqlhfissylpafqndfenlsteeksiikeem llevnrfalashflwglwsivqakissiefgymdyaqarfdayfhqkrklgv
Timeline for d5eqpa_: