Lineage for d5enua1 (5enu A:1-153)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879318Species Burkholderia ambifaria [TaxId:398577] [311498] (1 PDB entry)
  8. 2879319Domain d5enua1: 5enu A:1-153 [310516]
    Other proteins in same PDB: d5enua2
    automated match to d5dvbc_

Details for d5enua1

PDB Entry: 5enu (more details), 1.35 Å

PDB Description: crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria
PDB Compounds: (A:) Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen

SCOPe Domain Sequences for d5enua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5enua1 c.47.1.0 (A:1-153) automated matches {Burkholderia ambifaria [TaxId: 398577]}
msvevdrqvpdftapatggdislsdlkgrklvlyfypkdntpgctteglqfrelypkfkk
agaeiigvsrdslrshdnfkaklelpfplisdadealcalfdvikmkkmygkevrgiers
tflidadgvlrqawrgikvpghvddvlsavqal

SCOPe Domain Coordinates for d5enua1:

Click to download the PDB-style file with coordinates for d5enua1.
(The format of our PDB-style files is described here.)

Timeline for d5enua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5enua2
View in 3D
Domains from other chains:
(mouse over for more information)
d5enub_