SCOPe 2.08: Domain d5enua1: 5enu A:1-153

Lineage for d5enua1 (5enu A:1-153)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Burkholderia ambifaria [TaxId:398577] [311498] (1 PDB entry)

8. Domain d5enua1: 5enu A:1-153 [310516]
   Other proteins in same PDB: d5enua2
   automated match to d5dvbc_

Details for d5enua1

PDB Entry: 5enu, 1.35 Å

PDB Description: crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria

PDB Compounds: (A:) Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen

SCOPe Domain Sequences for d5enua1:

Sequence; same for both SEQRES and ATOM records:

>d5enua1 c.47.1.0 (A:1-153) automated matches {Burkholderia ambifaria [TaxId: 398577]}
msvevdrqvpdftapatggdislsdlkgrklvlyfypkdntpgctteglqfrelypkfkk
agaeiigvsrdslrshdnfkaklelpfplisdadealcalfdvikmkkmygkevrgiers
tflidadgvlrqawrgikvpghvddvlsavqal

Timeline for d5enua1:

• d5enua1 first appeared in SCOPe 2.06
  
• d5enua1 appears in SCOPe 2.07