Lineage for d5en2b2 (5en2 B:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752408Domain d5en2b2: 5en2 B:108-212 [310515]
    Other proteins in same PDB: d5en2a_, d5en2b1
    automated match to d12e8l2
    complexed with cl, nag

Details for d5en2b2

PDB Entry: 5en2 (more details), 1.82 Å

PDB Description: molecular basis for antibody-mediated neutralization of new world hemorrhagic fever mammarenaviruses
PDB Compounds: (B:) GD01 light chain

SCOPe Domain Sequences for d5en2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5en2b2 b.1.1.2 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5en2b2:

Click to download the PDB-style file with coordinates for d5en2b2.
(The format of our PDB-style files is described here.)

Timeline for d5en2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5en2b1
View in 3D
Domains from other chains:
(mouse over for more information)
d5en2a_