SCOPe 2.08: Domain d5en2b2: 5en2 B:108-212

Lineage for d5en2b2 (5en2 B:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5en2b2: 5en2 B:108-212 [310515]
   Other proteins in same PDB: d5en2a_, d5en2b1
   automated match to d12e8l2
   complexed with cl, nag

Details for d5en2b2

PDB Entry: 5en2, 1.82 Å

PDB Description: molecular basis for antibody-mediated neutralization of new world hemorrhagic fever mammarenaviruses

PDB Compounds: (B:) GD01 light chain

SCOPe Domain Sequences for d5en2b2:

Sequence; same for both SEQRES and ATOM records:

>d5en2b2 b.1.1.2 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d5en2b2:

• d5en2b2 first appeared in SCOPe 2.06
  
• d5en2b2 appears in SCOPe 2.07