Lineage for d5ej2c_ (5ej2 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847681Species Mycobacterium avium [TaxId:243243] [189589] (5 PDB entries)
  8. 2847700Domain d5ej2c_: 5ej2 C: [310509]
    complexed with mpd, nad, po4

Details for d5ej2c_

PDB Entry: 5ej2 (more details), 2.15 Å

PDB Description: crystal structure of carveol dehydrogenase from mycobacterium avium in complex with nad
PDB Compounds: (C:) carveol dehydrogenase

SCOPe Domain Sequences for d5ej2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ej2c_ c.2.1.0 (C:) automated matches {Mycobacterium avium [TaxId: 243243]}
tgrvagkvafisgaargqgrshavrlaqegadiiaidicgpienlayphstpedlaetad
lvkdldrrivtaqvdvrdfealksavdsgveqlgrldiivanagvgtdgrklhkirdnvw
qdmidinltgvwhtvkagvphvlsggrggsivltssvggrkaypntghyiaakhgviglm
rafavelgphmirvnavlptqvsttmvmndqtfrlfrpdlenpgpddfapisqmmhtlpv
pwvdasdisnavlflasdesryvtgvslpvdagsllk

SCOPe Domain Coordinates for d5ej2c_:

Click to download the PDB-style file with coordinates for d5ej2c_.
(The format of our PDB-style files is described here.)

Timeline for d5ej2c_: