| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Antrodiella faginea [TaxId:92699] [277511] (1 PDB entry) |
| Domain d5ehfa2: 5ehf A:131-302 [310503] automated match to d1gyca2 complexed with cu, gol, nag, zn |
PDB Entry: 5ehf (more details), 1.75 Å
SCOPe Domain Sequences for d5ehfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ehfa2 b.6.1.0 (A:131-302) automated matches {Antrodiella faginea [TaxId: 92699]}
dplkqlydvddestvmtladwyhtlarqeppgpvtpdstlinglgrapgqttpselavlt
vkrgtryrirliniscepnyhysidnhdltvieadgvstqsltvssltifagqrysfiln
anqpvgnywiraqpndaadvtfngginsailryegapvaepnttagpdntpl
Timeline for d5ehfa2: