Lineage for d5ehfa1 (5ehf A:1-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772323Species Antrodiella faginea [TaxId:92699] [277511] (1 PDB entry)
  8. 2772324Domain d5ehfa1: 5ehf A:1-130 [310502]
    automated match to d1gyca1
    complexed with cu, gol, nag, zn

Details for d5ehfa1

PDB Entry: 5ehf (more details), 1.75 Å

PDB Description: laccase from antrodiella faginea
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d5ehfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ehfa1 b.6.1.0 (A:1-130) automated matches {Antrodiella faginea [TaxId: 92699]}
aigpvadlkivnaniqpdgftrpavlaggtfpgplikgnkgdnfqlnvidelenedmlks
tsihwhgffqhgtnwadgpafvnqcpittghsflynfhvpdqagtfwyhshlstqycdgl
rgpmvvydph

SCOPe Domain Coordinates for d5ehfa1:

Click to download the PDB-style file with coordinates for d5ehfa1.
(The format of our PDB-style files is described here.)

Timeline for d5ehfa1: