![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Antrodiella faginea [TaxId:92699] [277511] (1 PDB entry) |
![]() | Domain d5ehfa1: 5ehf A:1-130 [310502] automated match to d1gyca1 complexed with cu, gol, nag, zn |
PDB Entry: 5ehf (more details), 1.75 Å
SCOPe Domain Sequences for d5ehfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ehfa1 b.6.1.0 (A:1-130) automated matches {Antrodiella faginea [TaxId: 92699]} aigpvadlkivnaniqpdgftrpavlaggtfpgplikgnkgdnfqlnvidelenedmlks tsihwhgffqhgtnwadgpafvnqcpittghsflynfhvpdqagtfwyhshlstqycdgl rgpmvvydph
Timeline for d5ehfa1: