SCOPe 2.08: Domain d5eeoa1: 5eeo A:6-149

Lineage for d5eeoa1 (5eeo A:6-149)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries)

8. Domain d5eeoa1: 5eeo A:6-149 [310500]
   Other proteins in same PDB: d5eeoa2
   automated match to d1ygea2
   complexed with fe2

Details for d5eeoa1

PDB Entry: 5eeo, 2.1 Å

PDB Description: soybean lipoxygenase(l1)-t756r

PDB Compounds: (A:) Seed linoleate 13S-lipoxygenase-1

SCOPe Domain Sequences for d5eeoa1:

Sequence, based on SEQRES records:

>d5eeoa1 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records):

>d5eeoa1 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelnlnaflgrsvslqlisatkadahgkgkvgkdtflegintlgages
afnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvyntklyksvrif
fanhty

Timeline for d5eeoa1:

• d5eeoa1 first appeared in SCOPe 2.06
  
• d5eeoa1 appears in SCOPe 2.07