Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins) automatically mapped to Pfam PF00891 |
Protein Carminomycin 4-O-methyltransferase [110660] (1 species) |
Species Streptomyces peucetius [TaxId:1950] [110661] (6 PDB entries) Uniprot Q06528 |
Domain d5eehc2: 5eeh C:100-353 [310499] Other proteins in same PDB: d5eeha1, d5eehb1, d5eehc1 automated match to d1tw2b2 complexed with p9p, sah, so4 |
PDB Entry: 5eeh (more details), 1.82 Å
SCOPe Domain Sequences for d5eehc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eehc2 c.66.1.12 (C:100-353) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt ipydlsllvlapaa
Timeline for d5eehc2:
View in 3D Domains from other chains: (mouse over for more information) d5eeha1, d5eeha2, d5eehb1, d5eehb2 |