Lineage for d5eehc2 (5eeh C:100-353)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145451Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
    automatically mapped to Pfam PF00891
  6. 2145467Protein Carminomycin 4-O-methyltransferase [110660] (1 species)
  7. 2145468Species Streptomyces peucetius [TaxId:1950] [110661] (6 PDB entries)
    Uniprot Q06528
  8. 2145471Domain d5eehc2: 5eeh C:100-353 [310499]
    Other proteins in same PDB: d5eeha1, d5eehb1, d5eehc1
    automated match to d1tw2b2
    complexed with p9p, sah, so4

Details for d5eehc2

PDB Entry: 5eeh (more details), 1.82 Å

PDB Description: crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with sah and 2-chloro-4-nitrophenol
PDB Compounds: (C:) Carminomycin 4-O-methyltransferase DnrK

SCOPe Domain Sequences for d5eehc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eehc2 c.66.1.12 (C:100-353) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt
ipydlsllvlapaa

SCOPe Domain Coordinates for d5eehc2:

Click to download the PDB-style file with coordinates for d5eehc2.
(The format of our PDB-style files is described here.)

Timeline for d5eehc2: