![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins) automatically mapped to Pfam PF00891 |
![]() | Protein Carminomycin 4-O-methyltransferase [110660] (1 species) |
![]() | Species Streptomyces peucetius [TaxId:1950] [110661] (6 PDB entries) Uniprot Q06528 |
![]() | Domain d5eehb2: 5eeh B:100-352 [310497] Other proteins in same PDB: d5eeha1, d5eehb1, d5eehc1 automated match to d1tw2b2 complexed with p9p, sah, so4 |
PDB Entry: 5eeh (more details), 1.82 Å
SCOPe Domain Sequences for d5eehb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eehb2 c.66.1.12 (B:100-352) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt ipydlsllvlapa
Timeline for d5eehb2:
![]() Domains from other chains: (mouse over for more information) d5eeha1, d5eeha2, d5eehc1, d5eehc2 |