![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins) unknown function |
![]() | Protein Carminomycin 4-O-methyltransferase [109667] (1 species) |
![]() | Species Streptomyces peucetius [TaxId:1950] [109668] (6 PDB entries) Uniprot Q06528 |
![]() | Domain d5eehb1: 5eeh B:13-99 [310496] Other proteins in same PDB: d5eeha2, d5eehb2, d5eehc2 automated match to d1tw2b1 complexed with p9p, sah, so4 |
PDB Entry: 5eeh (more details), 1.82 Å
SCOPe Domain Sequences for d5eehb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eehb1 a.4.5.29 (B:13-99) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} qidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlirhl vaiglleedapgefvptevgelladdh
Timeline for d5eehb1:
![]() Domains from other chains: (mouse over for more information) d5eeha1, d5eeha2, d5eehc1, d5eehc2 |