SCOPe 2.08: Domain d5eehb1: 5eeh B:13-99

Lineage for d5eehb1 (5eeh B:13-99)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
   unknown function

6. Protein Carminomycin 4-O-methyltransferase [109667] (1 species)

7. Species Streptomyces peucetius [TaxId:1950] [109668] (6 PDB entries)
   Uniprot Q06528

8. Domain d5eehb1: 5eeh B:13-99 [310496]
   Other proteins in same PDB: d5eeha2, d5eehb2, d5eehc2
   automated match to d1tw2b1
   complexed with p9p, sah, so4

Details for d5eehb1

PDB Entry: 5eeh, 1.82 Å

PDB Description: crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with sah and 2-chloro-4-nitrophenol

PDB Compounds: (B:) Carminomycin 4-O-methyltransferase DnrK

SCOPe Domain Sequences for d5eehb1:

Sequence; same for both SEQRES and ATOM records:

>d5eehb1 a.4.5.29 (B:13-99) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
qidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlirhl
vaiglleedapgefvptevgelladdh

Timeline for d5eehb1:

• d5eehb1 first appeared in SCOPe 2.06
  
• d5eehb1 appears in SCOPe 2.07