SCOPe 2.08: Domain d5eeha2: 5eeh A:100-352

Lineage for d5eeha2 (5eeh A:100-352)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
   automatically mapped to Pfam PF00891

6. Protein Carminomycin 4-O-methyltransferase [110660] (1 species)

7. Species Streptomyces peucetius [TaxId:1950] [110661] (6 PDB entries)
   Uniprot Q06528

8. Domain d5eeha2: 5eeh A:100-352 [310495]
   Other proteins in same PDB: d5eeha1, d5eehb1, d5eehc1
   automated match to d1tw2b2
   complexed with p9p, sah, so4

Details for d5eeha2

PDB Entry: 5eeh, 1.82 Å

PDB Description: crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with sah and 2-chloro-4-nitrophenol

PDB Compounds: (A:) Carminomycin 4-O-methyltransferase DnrK

SCOPe Domain Sequences for d5eeha2:

Sequence; same for both SEQRES and ATOM records:

>d5eeha2 c.66.1.12 (A:100-352) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt
ipydlsllvlapa

Timeline for d5eeha2:

• d5eeha2 first appeared in SCOPe 2.06
  
• d5eeha2 appears in SCOPe 2.07