Lineage for d5eegb2 (5eeg B:100-352)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129522Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 protein domains)
    automatically mapped to Pfam PF00891
  6. 2129538Protein Carminomycin 4-O-methyltransferase [110660] (1 species)
  7. 2129539Species Streptomyces peucetius [TaxId:1950] [110661] (6 PDB entries)
    Uniprot Q06528
  8. 2129550Domain d5eegb2: 5eeg B:100-352 [310493]
    Other proteins in same PDB: d5eega1, d5eegb1
    automated match to d1tw2b2
    complexed with s8m

Details for d5eegb2

PDB Entry: 5eeg (more details), 2.26 Å

PDB Description: crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with tetrazole-sah
PDB Compounds: (B:) Carminomycin 4-O-methyltransferase DnrK

SCOPe Domain Sequences for d5eegb2:

Sequence, based on SEQRES records: (download)

>d5eegb2 c.66.1.12 (B:100-352) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt
ipydlsllvlapa

Sequence, based on observed residues (ATOM records): (download)

>d5eegb2 c.66.1.12 (B:100-352) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpsdl
sllvlapa

SCOPe Domain Coordinates for d5eegb2:

Click to download the PDB-style file with coordinates for d5eegb2.
(The format of our PDB-style files is described here.)

Timeline for d5eegb2:

  • d5eegb2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5eegb1