Lineage for d1vlzb_ (1vlz B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) Species Escherichia coli [TaxId:562] [52175] (24 PDB entries) 
Domain d1vlzb_: 1vlz B: [31049]
Details for d1vlzb_
PDB Entry: 1vlz (more details), 2.05 Å
PDB Description: uncoupled phosphorylation and activation in bacterial chemotaxis: the 2.1 angstrom structure of a threonine to isoleucine mutant at position 87 of chey
SCOP Domain Sequences for d1vlzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlzb_ c.23.1.1 (B:) CheY protein {Escherichia coli}
dkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpn
mdglellktiradgamsalpvlmviaeakkeniiaaaqagasgyvvkpftaatleeklnk
ifeklgm
SCOP Domain Coordinates for d1vlzb_:
Click to download the PDB-style file with coordinates for d1vlzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vlzb_:
- d1vlzb_ appears in SCOP 1.57
- d1vlzb_ appears in the current release, SCOPe 2.08
View in 3D
