Lineage for d5e8ra_ (5e8r A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130730Species Human (Homo sapiens) [TaxId:9606] [187871] (15 PDB entries)
  8. 2130760Domain d5e8ra_: 5e8r A: [310488]
    automated match to d4y30a_
    complexed with 5l6, cl, sah, unx

Details for d5e8ra_

PDB Entry: 5e8r (more details), 2.55 Å

PDB Description: human hmt1 hnrnp methyltransferase-like protein 6 (s. cerevisiae)
PDB Compounds: (A:) Protein arginine N-methyltransferase 6

SCOPe Domain Sequences for d5e8ra_:

Sequence, based on SEQRES records: (download)

>d5e8ra_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erdqlyyecysdvsvheemiadrvrtdayrlgilrnwaalrgktvldvgagtgilsifca
qagarrvyaveasaiwqqarevvrfngledrvhvlpgpvetvelpeqvdaivsewmgygl
lhesmlssvlhartkwlkegglllpasaelfivpisdqmlewrlgfwsqvkqhygvdmsc
legfatrclmghseivvqglsgedvlarpqrfaqlelsragleqeleagvggrfrcscyg
sapmhgfaiwfqvtfpggesekplvlstspfhpathwkqallylnepvqveqdtdvsgei
tllpsrdnprrlrvllrykvgdqeektkdfamed

Sequence, based on observed residues (ATOM records): (download)

>d5e8ra_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erdqlyyecysdvsvheemiadrvrtdayrlgilrnwaalrgktvldvgagtgilsifca
qagarrvyaveasaiwqqarevvrfngledrvhvlpgpvetvelpeqvdaivsewmgygl
lhesmlssvlhartkwlkegglllpasaelfivpisdqmlewrlgfwsqvkqhygvdmsc
legfatrclmghseivvqglsgedvlarpqrfaqlelsragleqeleagvggrfrcscyg
sapmhgfaiwfqvtfpggekplvlstspfhpathwkqallylnepvqveqdtdvsgeitl
lpsrdnprrlrvllrykvgdqeektkdfamed

SCOPe Domain Coordinates for d5e8ra_:

Click to download the PDB-style file with coordinates for d5e8ra_.
(The format of our PDB-style files is described here.)

Timeline for d5e8ra_:

  • d5e8ra_ is new in SCOPe 2.06-stable