| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.21: ets domain [46859] (9 proteins) |
| Protein automated matches [191121] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries) |
| Domain d5e8gc_: 5e8g C: [310486] automated match to d1flia_ complexed with co |
PDB Entry: 5e8g (more details), 2.7 Å
SCOPe Domain Sequences for d5e8gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e8gc_ a.4.5.21 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydklsra
lryyydknimtkvhgkryaykfdfhgiaqalqp
Timeline for d5e8gc_: