SCOPe 2.07: Domain d5e8dl2: 5e8d L:107-212

Lineage for d5e8dl2 (5e8d L:107-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d5e8dl2: 5e8d L:107-212 [310483]
   Other proteins in same PDB: d5e8da_, d5e8dl1
   automated match to d1h3pl2
   complexed with cl, gol

Details for d5e8dl2

PDB Entry: 5e8d, 2.5 Å

PDB Description: crystal structure of human epiregulin in complex with the fab fragment of murine monoclonal antibody 9e5

PDB Compounds: (L:) anti-human epiregulin antibody 9E5 Fab light chain

SCOPe Domain Sequences for d5e8dl2:

Sequence; same for both SEQRES and ATOM records:

>d5e8dl2 b.1.1.2 (L:107-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d5e8dl2:

• d5e8dl2 first appeared in SCOPe 2.06
  
• d5e8dl2 appears in the current release, SCOPe 2.08