Lineage for d5e8dl1 (5e8d L:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370899Domain d5e8dl1: 5e8d L:1-106 [310482]
    Other proteins in same PDB: d5e8da_, d5e8dl2
    automated match to d1h3pl1
    complexed with cl, gol

Details for d5e8dl1

PDB Entry: 5e8d (more details), 2.5 Å

PDB Description: crystal structure of human epiregulin in complex with the fab fragment of murine monoclonal antibody 9e5
PDB Compounds: (L:) anti-human epiregulin antibody 9E5 Fab light chain

SCOPe Domain Sequences for d5e8dl1:

Sequence, based on SEQRES records: (download)

>d5e8dl1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslggkvtitckasqdinkyiawyqhkpgkgprllihytstlhpgips
rfsgsgsgrdysfsisnlepediatyyclqydnlrtfgggtkleik

Sequence, based on observed residues (ATOM records): (download)

>d5e8dl1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsasgkvtitckasqdinkyiawyqhkpgkgprllihytstlhpgipsrf
sgsgsgrdysfsisnlepediatyyclqydnlrtfgggtkleik

SCOPe Domain Coordinates for d5e8dl1:

Click to download the PDB-style file with coordinates for d5e8dl1.
(The format of our PDB-style files is described here.)

Timeline for d5e8dl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5e8dl2
View in 3D
Domains from other chains:
(mouse over for more information)
d5e8da_