SCOPe 2.08: Domain d5e8dl1: 5e8d L:1-106

Lineage for d5e8dl1 (5e8d L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5e8dl1: 5e8d L:1-106 [310482]
   Other proteins in same PDB: d5e8da_, d5e8dh_, d5e8dl2
   automated match to d1h3pl1
   complexed with cl, gol

Details for d5e8dl1

PDB Entry: 5e8d, 2.5 Å

PDB Description: crystal structure of human epiregulin in complex with the fab fragment of murine monoclonal antibody 9e5

PDB Compounds: (L:) anti-human epiregulin antibody 9E5 Fab light chain

SCOPe Domain Sequences for d5e8dl1:

Sequence, based on SEQRES records:

>d5e8dl1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslggkvtitckasqdinkyiawyqhkpgkgprllihytstlhpgips
rfsgsgsgrdysfsisnlepediatyyclqydnlrtfgggtkleik

Sequence, based on observed residues (ATOM records):

>d5e8dl1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsasgkvtitckasqdinkyiawyqhkpgkgprllihytstlhpgipsrf
sgsgsgrdysfsisnlepediatyyclqydnlrtfgggtkleik

Timeline for d5e8dl1:

• d5e8dl1 first appeared in SCOPe 2.06
  
• d5e8dl1 appears in SCOPe 2.07