Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Escherichia coli [TaxId:331111] [311497] (3 PDB entries) |
Domain d5e70d3: 5e70 D:623-728 [310480] Other proteins in same PDB: d5e70a1, d5e70a2, d5e70b1, d5e70b2, d5e70c1, d5e70c2, d5e70d1, d5e70d2 automated match to d1m7xa2 complexed with gol, rcd |
PDB Entry: 5e70 (more details), 2.33 Å
SCOPe Domain Sequences for d5e70d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e70d3 b.71.1.0 (D:623-728) automated matches {Escherichia coli [TaxId: 331111]} pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
Timeline for d5e70d3: