Lineage for d5e70c1 (5e70 C:118-226)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039628Species Escherichia coli [TaxId:331111] [311495] (3 PDB entries)
  8. 2039635Domain d5e70c1: 5e70 C:118-226 [310475]
    Other proteins in same PDB: d5e70a2, d5e70a3, d5e70b2, d5e70b3, d5e70c2, d5e70c3, d5e70d2, d5e70d3
    automated match to d1m7xa1
    complexed with gol, rcd

Details for d5e70c1

PDB Entry: 5e70 (more details), 2.33 Å

PDB Description: crystal structure of ecoli branching enzyme with gamma cyclodextrin
PDB Compounds: (C:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d5e70c1:

Sequence, based on SEQRES records: (download)

>d5e70c1 b.1.18.0 (C:118-226) automated matches {Escherichia coli [TaxId: 331111]}
hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
fipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

Sequence, based on observed residues (ATOM records): (download)

>d5e70c1 b.1.18.0 (C:118-226) automated matches {Escherichia coli [TaxId: 331111]}
hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
fipgahngqlykyemidangnlrlksdpyafeaqetaslicglpek

SCOPe Domain Coordinates for d5e70c1:

Click to download the PDB-style file with coordinates for d5e70c1.
(The format of our PDB-style files is described here.)

Timeline for d5e70c1: