SCOPe 2.07: Domain d5e70b1: 5e70 B:117-226

Lineage for d5e70b1 (5e70 B:117-226)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Escherichia coli [TaxId:331111] [311495] (3 PDB entries)

8. Domain d5e70b1: 5e70 B:117-226 [310472]
   Other proteins in same PDB: d5e70a2, d5e70a3, d5e70b2, d5e70b3, d5e70c2, d5e70c3, d5e70d2, d5e70d3
   automated match to d1m7xa1
   complexed with gol, rcd

Details for d5e70b1

PDB Entry: 5e70, 2.33 Å

PDB Description: crystal structure of ecoli branching enzyme with gamma cyclodextrin

PDB Compounds: (B:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d5e70b1:

Sequence; same for both SEQRES and ATOM records:

>d5e70b1 b.1.18.0 (B:117-226) automated matches {Escherichia coli [TaxId: 331111]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

Timeline for d5e70b1:

• d5e70b1 first appeared in SCOPe 2.06
  
• d5e70b1 appears in the current release, SCOPe 2.08