![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (55 species) not a true protein |
![]() | Species Escherichia coli [TaxId:331111] [311495] (3 PDB entries) |
![]() | Domain d5e70b1: 5e70 B:117-226 [310472] Other proteins in same PDB: d5e70a2, d5e70a3, d5e70b2, d5e70b3, d5e70c2, d5e70c3, d5e70d2, d5e70d3 automated match to d1m7xa1 complexed with gol, rcd |
PDB Entry: 5e70 (more details), 2.33 Å
SCOPe Domain Sequences for d5e70b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e70b1 b.1.18.0 (B:117-226) automated matches {Escherichia coli [TaxId: 331111]} thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek
Timeline for d5e70b1: