Lineage for d1d4za_ (1d4z A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463707Protein CheY protein [52174] (5 species)
  7. 2463708Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 2463723Domain d1d4za_: 1d4z A: [31047]
    complexed with so4; mutant

Details for d1d4za_

PDB Entry: 1d4z (more details), 1.9 Å

PDB Description: crystal structure of chey-95iv, a hyperactive chey mutant
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1d4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4za_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkenviaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d1d4za_:

Click to download the PDB-style file with coordinates for d1d4za_.
(The format of our PDB-style files is described here.)

Timeline for d1d4za_: