Lineage for d1d4za_ (1d4z A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) Species Escherichia coli [TaxId:562] [52175] (24 PDB entries) 
Domain d1d4za_: 1d4z A: [31047]
Details for d1d4za_
PDB Entry: 1d4z (more details), 1.9 Å
PDB Description: crystal structure of chey-95iv, a hyperactive chey mutant
SCOP Domain Sequences for d1d4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d4za_ c.23.1.1 (A:) CheY protein {Escherichia coli}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkenviaaaqagasgyvvkpftpatleekln
kifeklgm
SCOP Domain Coordinates for d1d4za_:
Click to download the PDB-style file with coordinates for d1d4za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d4za_:
- d1d4za_ appears in SCOP 1.57
- d1d4za_ appears in the current release, SCOPe 2.08
View in 3D