Lineage for d1c4wa_ (1c4w A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) Species Escherichia coli [TaxId:562] [52175] (24 PDB entries) 
Domain d1c4wa_: 1c4w A: [31046]
Details for d1c4wa_
PDB Entry: 1c4w (more details), 1.84 Å
PDB Description: 1.9 a structure of a-thiophosphonate modified chey d57c
SCOP Domain Sequences for d1c4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4wa_ c.23.1.1 (A:) CheY protein {Escherichia coli}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfviscwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
SCOP Domain Coordinates for d1c4wa_:
Click to download the PDB-style file with coordinates for d1c4wa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c4wa_:
- d1c4wa_ appears in SCOP 1.57
- d1c4wa_ appears in the current release, SCOPe 2.08
View in 3D