Lineage for d5e6yd3 (5e6y D:623-728)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420486Species Escherichia coli [TaxId:331111] [311497] (3 PDB entries)
  8. 2420498Domain d5e6yd3: 5e6y D:623-728 [310456]
    Other proteins in same PDB: d5e6ya1, d5e6ya2, d5e6yb1, d5e6yb2, d5e6yc1, d5e6yc2, d5e6yd1, d5e6yd2
    automated match to d1m7xa2
    complexed with acx, gol

Details for d5e6yd3

PDB Entry: 5e6y (more details), 2.6 Å

PDB Description: crystal structure of e.coli branching enzyme in complex with alpha cyclodextrin
PDB Compounds: (D:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d5e6yd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e6yd3 b.71.1.0 (D:623-728) automated matches {Escherichia coli [TaxId: 331111]}
pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae

SCOPe Domain Coordinates for d5e6yd3:

Click to download the PDB-style file with coordinates for d5e6yd3.
(The format of our PDB-style files is described here.)

Timeline for d5e6yd3: