Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Escherichia coli [TaxId:331111] [311495] (3 PDB entries) |
Domain d5e6yd1: 5e6y D:117-226 [310454] Other proteins in same PDB: d5e6ya2, d5e6ya3, d5e6yb2, d5e6yb3, d5e6yc2, d5e6yc3, d5e6yd2, d5e6yd3 automated match to d1m7xa1 complexed with gol |
PDB Entry: 5e6y (more details), 2.6 Å
SCOPe Domain Sequences for d5e6yd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e6yd1 b.1.18.0 (D:117-226) automated matches {Escherichia coli [TaxId: 331111]} thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek
Timeline for d5e6yd1: