Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Escherichia coli [TaxId:331111] [311497] (3 PDB entries) |
Domain d5e6yc3: 5e6y C:623-728 [310453] Other proteins in same PDB: d5e6ya1, d5e6ya2, d5e6yb1, d5e6yb2, d5e6yc1, d5e6yc2, d5e6yd1, d5e6yd2 automated match to d1m7xa2 complexed with acx, gol |
PDB Entry: 5e6y (more details), 2.6 Å
SCOPe Domain Sequences for d5e6yc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e6yc3 b.71.1.0 (C:623-728) automated matches {Escherichia coli [TaxId: 331111]} pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
Timeline for d5e6yc3: