SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5e6yc1 (5e6y C:117-226)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (49 species)
    not a true protein
  7. 2033123Species Escherichia coli [TaxId:331111] [311495] (3 PDB entries)
  8. 2033134Domain d5e6yc1: 5e6y C:117-226 [310451]
    Other proteins in same PDB: d5e6ya2, d5e6ya3, d5e6yb2, d5e6yb3, d5e6yc2, d5e6yc3, d5e6yd2, d5e6yd3
    automated match to d1m7xa1
    complexed with acx, gol

Details for d5e6yc1

PDB Entry: 5e6y (more details), 2.6 Å

PDB Description: crystal structure of e.coli branching enzyme in complex with alpha cyclodextrin
PDB Compounds: (C:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d5e6yc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e6yc1 b.1.18.0 (C:117-226) automated matches {Escherichia coli [TaxId: 331111]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

SCOPe Domain Coordinates for d5e6yc1:

Click to download the PDB-style file with coordinates for d5e6yc1.
(The format of our PDB-style files is described here.)

Timeline for d5e6yc1:

  • d5e6yc1 is new in SCOPe 2.06-stable