Lineage for d1ymva_ (1ymv A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. Protein CheY protein [52174] (6 species)
  7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. Domain d1ymva_: 1ymv A: [31045]
    complexed with mg; mutant

Details for d1ymva_

PDB Entry: 1ymv (more details), 1.9 Å

PDB Description: signal transduction protein chey mutant with phe 14 replaced by gly, ser 15 replaced by gly, and met 17 replaced by gly
PDB Compounds: (A:) chey

SCOPe Domain Sequences for d1ymva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymva_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
lkflvvddggtgrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmdg
lellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnkife
klgm

SCOPe Domain Coordinates for d1ymva_ are not available.

Timeline for d1ymva_: