Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (22 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255480] (4 PDB entries) |
Domain d5e6na1: 5e6n A:17-126 [310441] Other proteins in same PDB: d5e6na2, d5e6nb2 automated match to d4zdva_ |
PDB Entry: 5e6n (more details), 2.1 Å
SCOPe Domain Sequences for d5e6na1:
Sequence, based on SEQRES records: (download)
>d5e6na1 d.15.1.0 (A:17-126) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} fkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckflvpehitvaelmsi vrrrlqlhpqqaffllvnersmvsnsmsmsnlysqerdpdgfvymvytsq
>d5e6na1 d.15.1.0 (A:17-126) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} fkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckflvpehitvaelmsi vrrrlqlhpqqaffllvnersmnsmsmsnlysqerdpdgfvymvytsq
Timeline for d5e6na1: