Lineage for d5e6na1 (5e6n A:17-126)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178975Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255480] (4 PDB entries)
  8. 2178976Domain d5e6na1: 5e6n A:17-126 [310441]
    Other proteins in same PDB: d5e6na2, d5e6nb2
    automated match to d4zdva_

Details for d5e6na1

PDB Entry: 5e6n (more details), 2.1 Å

PDB Description: crystal structure of c. elegans lgg-2
PDB Compounds: (A:) Protein lgg-2

SCOPe Domain Sequences for d5e6na1:

Sequence, based on SEQRES records: (download)

>d5e6na1 d.15.1.0 (A:17-126) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
fkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckflvpehitvaelmsi
vrrrlqlhpqqaffllvnersmvsnsmsmsnlysqerdpdgfvymvytsq

Sequence, based on observed residues (ATOM records): (download)

>d5e6na1 d.15.1.0 (A:17-126) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
fkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckflvpehitvaelmsi
vrrrlqlhpqqaffllvnersmnsmsmsnlysqerdpdgfvymvytsq

SCOPe Domain Coordinates for d5e6na1:

Click to download the PDB-style file with coordinates for d5e6na1.
(The format of our PDB-style files is described here.)

Timeline for d5e6na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5e6na2