Lineage for d5e4ra3 (5e4r A:339-476)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006836Species Ignisphaera aggregans [TaxId:583356] [271788] (3 PDB entries)
  8. 2006841Domain d5e4ra3: 5e4r A:339-476 [310440]
    Other proteins in same PDB: d5e4ra1
    automated match to d4xdza2
    complexed with 40e, edo, gol, mg, nap

Details for d5e4ra3

PDB Entry: 5e4r (more details), 1.94 Å

PDB Description: crystal structure of domain-duplicated synthetic class ii ketol-acid reductoisomerase 2ia_kari-dd
PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d5e4ra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e4ra3 a.100.1.0 (A:339-476) automated matches {Ignisphaera aggregans [TaxId: 583356]}
lfgeqvilvggimelikasfetlveegyqpevayfetvnelklivdliyekgltgmlrav
sdtakyggitvgkfiidksvrdkmkivlerirsgefarewikeyergmptvfkelseleg
stietvgrklremmfrgm

SCOPe Domain Coordinates for d5e4ra3:

Click to download the PDB-style file with coordinates for d5e4ra3.
(The format of our PDB-style files is described here.)

Timeline for d5e4ra3: