Lineage for d1udrd_ (1udr D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 390874Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 390875Family c.23.1.1: CheY-related [52173] (16 proteins)
  6. 390883Protein CheY protein [52174] (4 species)
  7. 390884Species Escherichia coli [TaxId:562] [52175] (30 PDB entries)
  8. 390892Domain d1udrd_: 1udr D: [31044]
    mutant

Details for d1udrd_

PDB Entry: 1udr (more details), 1.9 Å

PDB Description: chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4)

SCOP Domain Sequences for d1udrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udrd_ c.23.1.1 (D:) CheY protein {Escherichia coli}
kelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnm
dglellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnki
feklgm

SCOP Domain Coordinates for d1udrd_:

Click to download the PDB-style file with coordinates for d1udrd_.
(The format of our PDB-style files is described here.)

Timeline for d1udrd_: