| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Ignisphaera aggregans [TaxId:583356] [271788] (3 PDB entries) |
| Domain d5e4ra2: 5e4r A:184-329 [310439] Other proteins in same PDB: d5e4ra1 automated match to d4xdza2 complexed with 40e, edo, gol, mg, nap |
PDB Entry: 5e4r (more details), 1.94 Å
SCOPe Domain Sequences for d5e4ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e4ra2 a.100.1.0 (A:184-329) automated matches {Ignisphaera aggregans [TaxId: 583356]}
fkeetetdlfgeqvilvggimelikasfetlveegyqpevayfetvnelklivdliyekg
ltgmlravsdtakyggitvgkfiidksvrdkmkivlerirsgefarewikeyergmptvf
kelselegstietvgrklremmfrgm
Timeline for d5e4ra2: