Lineage for d5e47c_ (5e47 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066532Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2066533Family b.69.15.1: RPE65-like [310643] (2 protein domains)
  6. 2066561Protein automated matches [310886] (2 species)
    not a true protein
  7. 2066574Species Synechocystis sp. [TaxId:1111708] [311494] (5 PDB entries)
  8. 2066577Domain d5e47c_: 5e47 C: [310436]
    automated match to d2biwa_
    complexed with cl, fe2; mutant

Details for d5e47c_

PDB Entry: 5e47 (more details), 2.8 Å

PDB Description: synechocystis aco mutant - t136a
PDB Compounds: (C:) Apocarotenoid-15,15'-oxygenase

SCOPe Domain Sequences for d5e47c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e47c_ b.69.15.1 (C:) automated matches {Synechocystis sp. [TaxId: 1111708]}
qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
niananitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt

SCOPe Domain Coordinates for d5e47c_:

Click to download the PDB-style file with coordinates for d5e47c_.
(The format of our PDB-style files is described here.)

Timeline for d5e47c_:

  • d5e47c_ is new in SCOPe 2.06-stable