Lineage for d5dyfa4 (5dyf A:540-867)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2009600Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2010192Family a.118.1.27: Aminopeptidase N (APN) C-terminal-like [254179] (1 protein)
    PubMed 17876832; C-terminal part of Pfam PF11940
    this is a repeat family; one repeat unit is 4pvb A:690-721 found in domain
  6. 2010193Protein Aminopeptidase N (APN) C-terminal domain [254402] (1 species)
  7. 2010194Species Neisseria meningitidis [TaxId:122586] [254838] (9 PDB entries)
  8. 2010202Domain d5dyfa4: 5dyf A:540-867 [310431]
    Other proteins in same PDB: d5dyfa1, d5dyfa2, d5dyfa3
    automated match to d2gtqa4
    complexed with 5hr, gol, imd, so4, zn

Details for d5dyfa4

PDB Entry: 5dyf (more details), 1.85 Å

PDB Description: the crystal structure of aminopeptidase n in complex with n-benzyl-1, 2-diaminoethylphosphonic acid
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5dyfa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dyfa4 a.118.1.27 (A:540-867) Aminopeptidase N (APN) C-terminal domain {Neisseria meningitidis [TaxId: 122586]}
pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis
ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa
kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn
gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk
arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn
lvkqalqriraqeglskdvgeivgkild

SCOPe Domain Coordinates for d5dyfa4:

Click to download the PDB-style file with coordinates for d5dyfa4.
(The format of our PDB-style files is described here.)

Timeline for d5dyfa4: