Lineage for d5dyfa3 (5dyf A:439-539)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376781Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2376782Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)
  6. 2376783Protein Aminopeptidase N (APN) domain 3 [254401] (1 species)
    PubMed 17876832; N-terminal part of Pfam PF11940
  7. 2376784Species Neisseria meningitidis [TaxId:122586] [254837] (9 PDB entries)
  8. 2376791Domain d5dyfa3: 5dyf A:439-539 [310430]
    Other proteins in same PDB: d5dyfa1, d5dyfa2, d5dyfa4
    automated match to d2gtqa3
    complexed with 5hr, gol, imd, so4, zn

Details for d5dyfa3

PDB Entry: 5dyf (more details), 1.85 Å

PDB Description: the crystal structure of aminopeptidase n in complex with n-benzyl-1, 2-diaminoethylphosphonic acid
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5dyfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dyfa3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

SCOPe Domain Coordinates for d5dyfa3:

Click to download the PDB-style file with coordinates for d5dyfa3.
(The format of our PDB-style files is described here.)

Timeline for d5dyfa3: