SCOPe 2.06: Domain d5dyfa2: 5dyf A:189-438

Lineage for d5dyfa2 (5dyf A:189-438)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
   adopts thermolysin-like fold

6. Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species)

7. Species Neisseria meningitidis [TaxId:122586] [254836] (9 PDB entries)

8. Domain d5dyfa2: 5dyf A:189-438 [310429]
   Other proteins in same PDB: d5dyfa1, d5dyfa3, d5dyfa4
   automated match to d2gtqa2
   complexed with 5hr, gol, imd, so4, zn

Details for d5dyfa2

PDB Entry: 5dyf, 1.85 Å

PDB Description: the crystal structure of aminopeptidase n in complex with n-benzyl-1, 2-diaminoethylphosphonic acid

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5dyfa2:

Sequence; same for both SEQRES and ATOM records:

>d5dyfa2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

Timeline for d5dyfa2:

• d5dyfa2 is new in SCOPe 2.06-stable
  
• d5dyfa2 appears in SCOPe 2.07
  
• d5dyfa2 appears in the current release, SCOPe 2.08