Lineage for d5dxdb_ (5dxd B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781194Species Mycobacterium abscessus [TaxId:561007] [311493] (1 PDB entry)
  8. 2781196Domain d5dxdb_: 5dxd B: [310427]
    automated match to d2hyka_
    complexed with na

Details for d5dxdb_

PDB Entry: 5dxd (more details), 1.7 Å

PDB Description: crystal structure of putative beta-glucanase (rv0315 ortholog) from mycobacterium abscessus
PDB Compounds: (B:) Putative beta-glucanase

SCOPe Domain Sequences for d5dxdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dxdb_ b.29.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
gfvfrdefdgpagsapdgskwvaakfreriknpvfwdrpenmgeyrdsrtnifldgnsnl
viratkegnkyfsgklhgtfrggmghtfearikfncltdgcwpawwllndnperggeidm
aewygnrdwpsgttvharldgtsfetlpvpidsnwhtwrctwteaglyfwmdyhdgmepy
ltvdanslddwpfndpgytlqpmlnlavagsgggdpaggsypaemlvdyvrvw

SCOPe Domain Coordinates for d5dxdb_:

Click to download the PDB-style file with coordinates for d5dxdb_.
(The format of our PDB-style files is described here.)

Timeline for d5dxdb_: