SCOPe 2.08: Domain d5dxdb_: 5dxd B:

Lineage for d5dxdb_ (5dxd B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [311493] (1 PDB entry)

8. Domain d5dxdb_: 5dxd B: [310427]
   automated match to d2hyka_
   complexed with na

Details for d5dxdb_

PDB Entry: 5dxd, 1.7 Å

PDB Description: crystal structure of putative beta-glucanase (rv0315 ortholog) from mycobacterium abscessus

PDB Compounds: (B:) Putative beta-glucanase

SCOPe Domain Sequences for d5dxdb_:

Sequence; same for both SEQRES and ATOM records:

>d5dxdb_ b.29.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
gfvfrdefdgpagsapdgskwvaakfreriknpvfwdrpenmgeyrdsrtnifldgnsnl
viratkegnkyfsgklhgtfrggmghtfearikfncltdgcwpawwllndnperggeidm
aewygnrdwpsgttvharldgtsfetlpvpidsnwhtwrctwteaglyfwmdyhdgmepy
ltvdanslddwpfndpgytlqpmlnlavagsgggdpaggsypaemlvdyvrvw

Timeline for d5dxdb_:

• d5dxdb_ first appeared in SCOPe 2.06
  
• d5dxdb_ appears in SCOPe 2.07