| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Mycobacterium abscessus [TaxId:561007] [311493] (1 PDB entry) |
| Domain d5dxda_: 5dxd A: [310426] automated match to d2hyka_ complexed with na |
PDB Entry: 5dxd (more details), 1.7 Å
SCOPe Domain Sequences for d5dxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dxda_ b.29.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
gfvfrdefdgpagsapdgskwvaakfreriknpvfwdrpenmgeyrdsrtnifldgnsnl
viratkegnkyfsgklhgtfrggmghtfearikfncltdgcwpawwllndnperggeidm
aewygnrdwpsgttvharldgtsfetlpvpidsnwhtwrctwteaglyfwmdyhdgmepy
ltvdanslddwpfndpgytlqpmlnlavagsgggdpaggsypaemlvdyvrvw
Timeline for d5dxda_: