![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (42 species) not a true protein |
![]() | Species Brucella ovis [TaxId:444178] [278686] (2 PDB entries) |
![]() | Domain d5dwmd_: 5dwm D: [310425] Other proteins in same PDB: d5dwma2 automated match to d5dwnd_ complexed with edo, gol, imd |
PDB Entry: 5dwm (more details), 1.45 Å
SCOPe Domain Sequences for d5dwmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dwmd_ d.108.1.0 (D:) automated matches {Brucella ovis [TaxId: 444178]} mpvirdfqpadietitaiytqavltgtgsyeiepptmdemakrfaafadqgfpilvaead grvlgyayasyfrvrpayrwlaedsiyiapdakgqgigklllreliarisalgfrqllav igdgehnigsvklheslgfthcgriegsgfkhgrwldtvlmqlplnggrstepgpspls
Timeline for d5dwmd_:
![]() Domains from other chains: (mouse over for more information) d5dwma1, d5dwma2, d5dwmb_, d5dwmc_ |