SCOP 1.71: Domain d1udrb_: 1udr B:

Lineage for d1udrb_ (1udr B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (5 families)

5. Family c.23.1.1: CheY-related [52173] (18 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Escherichia coli [TaxId:562] [52175] (31 PDB entries)

8. Domain d1udrb_: 1udr B: [31042]

Details for d1udrb_

PDB Entry: 1udr, 1.9 Å

PDB Description: chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4)

SCOP Domain Sequences for d1udrb_:

Sequence; same for both SEQRES and ATOM records:

>d1udrb_ c.23.1.1 (B:) CheY protein {Escherichia coli}
elkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
glellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnkif
eklgm

Timeline for d1udrb_:

• d1udrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1udrb_ appears in SCOP 1.69
  
• d1udrb_ appears in SCOP 1.73
  
• d1udrb_ appears in the current release, SCOPe 2.08