Lineage for d5durd1 (5dur D:3-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034113Domain d5durd1: 5dur D:3-113 [310417]
    Other proteins in same PDB: d5durd2, d5durl2
    automated match to d2mcg11
    complexed with nag

Details for d5durd1

PDB Entry: 5dur (more details), 2.82 Å

PDB Description: influenza a virus h5 hemagglutinin globular head in complex with antibody 100f4
PDB Compounds: (D:) Light Chain of Antibody 100F4

SCOPe Domain Sequences for d5durd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5durd1 b.1.1.0 (D:3-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqppsvsgapgqrvtipctggssnigagysvhwyqqlpgtapklliygsnsrpsgvpd
rfsgsksgtsaslaitglrpedeadyycqsydsslsgsqvfgagtrvtvlg

SCOPe Domain Coordinates for d5durd1:

Click to download the PDB-style file with coordinates for d5durd1.
(The format of our PDB-style files is described here.)

Timeline for d5durd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5durd2