Lineage for d5dqfa3 (5dqf A:388-583)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2337021Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2337022Protein automated matches [254493] (6 species)
    not a true protein
  7. 2337067Species Horse (Equus caballus) [TaxId:9796] [256129] (19 PDB entries)
  8. 2337088Domain d5dqfa3: 5dqf A:388-583 [310412]
    automated match to d1hk2a3
    complexed with cl, cze, lcr, pg4, so4

Details for d5dqfa3

PDB Entry: 5dqf (more details), 2.15 Å

PDB Description: horse serum albumin (esa) in complex with cetirizine
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5dqfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dqfa3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc
senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft
fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgaedkeacf
aeegpklvassqlala

SCOPe Domain Coordinates for d5dqfa3:

Click to download the PDB-style file with coordinates for d5dqfa3.
(The format of our PDB-style files is described here.)

Timeline for d5dqfa3: