Lineage for d5dqfa2 (5dqf A:196-387)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730752Species Horse (Equus caballus) [TaxId:9796] [256129] (26 PDB entries)
  8. 2730781Domain d5dqfa2: 5dqf A:196-387 [310411]
    automated match to d1hk5a2
    complexed with cl, cze, lcr, pg4, so4

Details for d5dqfa2

PDB Entry: 5dqf (more details), 2.15 Å

PDB Description: horse serum albumin (esa) in complex with cetirizine
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5dqfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dqfa2 a.126.1.0 (A:196-387) automated matches {Horse (Equus caballus) [TaxId: 9796]}
rlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhkecchgdllecadd
radlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpalaadfaedkeic
khykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaeadppacyrtvfdq
ftplveepkslv

SCOPe Domain Coordinates for d5dqfa2:

Click to download the PDB-style file with coordinates for d5dqfa2.
(The format of our PDB-style files is described here.)

Timeline for d5dqfa2: