![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Menin C-terminal domain [310725] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [310974] (33 PDB entries) |
![]() | Domain d5ddda2: 5ddd A:231-459 [310405] Other proteins in same PDB: d5ddda1, d5ddda3 automated match to d3u85a2 complexed with 59x, dms, peg, pg4, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5ddd (more details), 2.14 Å
SCOPe Domain Sequences for d5ddda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ddda2 a.118.8.1 (A:231-459) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick weegsptpvlhvgwatflvqslgrfegqvrqkvrivs
Timeline for d5ddda2: