Lineage for d5ddba2 (5ddb A:231-586)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007372Protein Menin C-terminal domain [310725] (2 species)
  7. 2007373Species Human (Homo sapiens) [TaxId:9606] [310974] (23 PDB entries)
  8. 2007379Domain d5ddba2: 5ddb A:231-586 [310403]
    Other proteins in same PDB: d5ddba1
    automated match to d3u85a2
    complexed with 59q, dms, peg, pg4, so4

Details for d5ddba2

PDB Entry: 5ddb (more details), 1.54 Å

PDB Description: menin in complex with mi-319
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d5ddba2:

Sequence, based on SEQRES records: (download)

>d5ddba2 a.118.8.1 (A:231-586) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivsvpapaaspppegpvltfqsekmk
gmkellvatkinssaiklqltaqsqvq

Sequence, based on observed residues (ATOM records): (download)

>d5ddba2 a.118.8.1 (A:231-586) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivspvltfqsekmkgmkellvatkin
ssaiklqltaqsqvq

SCOPe Domain Coordinates for d5ddba2:

Click to download the PDB-style file with coordinates for d5ddba2.
(The format of our PDB-style files is described here.)

Timeline for d5ddba2:

  • d5ddba2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5ddba1