SCOPe 2.08: Domain d5d7qa1: 5d7q A:56-354

Lineage for d5d7qa1 (5d7q A:56-354)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
   silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain

6. Protein Sirt2 histone deacetylase [63987] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63988] (23 PDB entries)

8. Domain d5d7qa1: 5d7q A:56-354 [310395]
   Other proteins in same PDB: d5d7qa2
   automated match to d5dy4a_
   complexed with 4i5, ar6, zn

Details for d5d7qa1

PDB Entry: 5d7q, 2.01 Å

PDB Description: crystal structure of human sirt2 in complex with adpr and chic35

PDB Compounds: (A:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d5d7qa1:

Sequence; same for both SEQRES and ATOM records:

>d5d7qa1 c.31.1.5 (A:56-354) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]}
erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp
eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdp
flgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasida

Timeline for d5d7qa1:

• d5d7qa1 first appeared in SCOPe 2.06
  
• d5d7qa1 appears in SCOPe 2.07