Lineage for d5d7qa1 (5d7q A:56-354)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862892Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2862953Protein Sirt2 histone deacetylase [63987] (1 species)
  7. 2862954Species Human (Homo sapiens) [TaxId:9606] [63988] (23 PDB entries)
  8. 2862981Domain d5d7qa1: 5d7q A:56-354 [310395]
    Other proteins in same PDB: d5d7qa2
    automated match to d5dy4a_
    complexed with 4i5, ar6, zn

Details for d5d7qa1

PDB Entry: 5d7q (more details), 2.01 Å

PDB Description: crystal structure of human sirt2 in complex with adpr and chic35
PDB Compounds: (A:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d5d7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d7qa1 c.31.1.5 (A:56-354) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]}
erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp
eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdp
flgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasida

SCOPe Domain Coordinates for d5d7qa1:

Click to download the PDB-style file with coordinates for d5d7qa1.
(The format of our PDB-style files is described here.)

Timeline for d5d7qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d7qa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5d7qb_