Lineage for d5d7oa_ (5d7o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862892Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2862953Protein Sirt2 histone deacetylase [63987] (1 species)
  7. 2862954Species Human (Homo sapiens) [TaxId:9606] [63988] (23 PDB entries)
  8. 2862960Domain d5d7oa_: 5d7o A: [310390]
    automated match to d5dy4a_
    complexed with ar6, pge, zn

Details for d5d7oa_

PDB Entry: 5d7o (more details), 1.63 Å

PDB Description: crystal structure of sirt2-adpr at an improved resolution
PDB Compounds: (A:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d5d7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d7oa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]}
rlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpype
aifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleria
gleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivffg
eslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdpf
lgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq

SCOPe Domain Coordinates for d5d7oa_:

Click to download the PDB-style file with coordinates for d5d7oa_.
(The format of our PDB-style files is described here.)

Timeline for d5d7oa_: